NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233396_1095226

Scaffold Ga0233396_1095226


Overview

Basic Information
Taxon OID3300024428 Open in IMG/M
Scaffold IDGa0233396_1095226 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 32D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)725
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003592Metagenome / Metatranscriptome478Y
F018076Metagenome / Metatranscriptome237N

Sequences

Protein IDFamilyRBSSequence
Ga0233396_10952261F018076N/AEQDSDFEMTARVVYLGRPRTSTTFLGLFRRETTTTEVRVVVELKNKKTGQVVSGNGTGTIDRDISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0233396_10952262F003592GAGGMRFKKYYKDILSLVGTLLLLGTTILINKYDVKQLYREFATLSLKVNAQEKKIEGLEDKVSVLIVQNQRLLKDLDEHNETRGSENALLMQKIQDLEYKFEVLSMKSTITNNGKVFNDRFEFVDKQENRIGKYETNGQVLVAWKDDYLATKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.