Scaffold Ga0209986_10039044

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209986_10039044

Scaffold Ga0209986_10039044

Overview

Basic Information
Taxon OID	3300024433 Open in IMG/M
Scaffold ID	Ga0209986_10039044 Open in IMG/M
Source Dataset Name	Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2930
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (85.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location Name	Atlantic Ocean: Black Sea
Coordinates	Lat. (^o)	44.288	Long. (^o)	34.983	Alt. (m)		Depth (m)	2075
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012772	Metagenome	277	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209986_100390444	F012772	AGGAGG	VTGESFYLDIDGVTWQYMLVTDPPAALYWNPSSYKLRLSDIKIATKCSPEDRKRLRREILKDIEETDDGIRC

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.