NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255176_1043942

Scaffold Ga0255176_1043942


Overview

Basic Information
Taxon OID3300024507 Open in IMG/M
Scaffold IDGa0255176_1043942 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)836
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000785Metagenome / Metatranscriptome891Y
F009005Metagenome / Metatranscriptome324Y
F027513Metagenome / Metatranscriptome194N

Sequences

Protein IDFamilyRBSSequence
Ga0255176_10439421F000785N/ASNKIGMRFDCNRLWNWAYEKLGESRCAAIAFYWDTKETAECGYYDWEKTIWINLAQCKRMIAVQKTLLHEWTHAQQSYRWYNHYQLQYGYKNNPYEIQARENEKLVKRAYRKRTK
Ga0255176_10439422F027513N/AVHTENEQNNKARPHANRHTKPGQQIATNRAMHNDMRLIENGEGEYDAVVIRGDKYSLIRGEYIPIGCNFHYPKVWGRKYAATKLLEYIMADKRKQIADAQRELDKLQRCLDKVNEWSDTD
Ga0255176_10439423F009005N/AMLTEQEMINRAVQLGMDEELVSYAKQIKRQLETEGDTADWLDCLEW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.