NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255056_10532196

Scaffold Ga0255056_10532196


Overview

Basic Information
Taxon OID3300024521 Open in IMG/M
Scaffold IDGa0255056_10532196 Open in IMG/M
Source Dataset NameSeawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)551
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameCanada: Northwest Territories
CoordinatesLat. (o)70.66Long. (o)-123.0Alt. (m)Depth (m)570
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025751Metagenome200Y

Sequences

Protein IDFamilyRBSSequence
Ga0255056_105321961F025751N/AALDDWEQTVYVYRINHAGRKIKPYVAKWGMHSGLLDSIRDDFGTGEYHLMIRHGKTMVFTGTIGVERPRNR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.