NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256308_1003239

Scaffold Ga0256308_1003239


Overview

Basic Information
Taxon OID3300024549 Open in IMG/M
Scaffold IDGa0256308_1003239 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3394
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036666Metagenome / Metatranscriptome169N
F039533Metagenome / Metatranscriptome163N

Sequences

Protein IDFamilyRBSSequence
Ga0256308_10032394F036666AGGMYNQGFQAVARAAAKLRQTAQGARILAEWLGDGGVPVDRRQAQDRIDTCNRCIHNKPTDARSVTKTVAEAILEQEQARNDMAMFLQGEGLAGTCEVCGCYLKLKVWVPLSYLGKTEMPDNCWISHERKAI
Ga0256308_10032395F039533N/AMSFKEPSRVWNVVSAMLEAEQPRSRNRARINSCFNGNPPYTQEEARDNRIQTNVNFLEGTRIIHASRQQFTNAFLKPQNYFSVGLDIGPRDKRTQWGNIITKQLNRVMKRSPKYSTVLESQFAATVLHGIGPVTWLRDRDWCPSARGTEDILVPTNTLTTMENLSHFAIYTSFTAQDLIRMTRGENVDP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.