NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255236_1036988

Scaffold Ga0255236_1036988


Overview

Basic Information
Taxon OID3300024563 Open in IMG/M
Scaffold IDGa0255236_1036988 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1149
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006181Metagenome / Metatranscriptome379Y
F010317Metagenome / Metatranscriptome305Y
F019468Metagenome / Metatranscriptome229N

Sequences

Protein IDFamilyRBSSequence
Ga0255236_10369881F010317AGAAGGMNKIYIEKLAEVPGGLPARNMEEHIDGQYQGDSHSIRVEYNLEGVLSYDIEVGKPVVVGRTKRNGVEAYGVFSTSRVTEVGNNYFKTMNSVYLYKYLSL
Ga0255236_10369882F019468N/AMTIEKTYKLSIKDTAYFLTEEEVTKLYEQCRKALNIDNANPYFPNYPPGVRKFDDDKTTPLNPTTPSIPYPYDTYPWYTPTYPSGPNYPYWTSPNTTTTCGTINAGEGNCVMDTNWQPNLCNTVKSSTDINFLSDDMAVHEDNQKWRSSVEQALDKLNANKKV
Ga0255236_10369883F006181N/AVHIIYPDEAVHSFVMETDMVVSDILERVFAEWNHGSGMESELFIRSKKRSLSVNDIVCVNGKYYLCESFGWNEVTPQFVNELEEEVSNHPNRIHGAWFALNDVMWDRKSKNNLELV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.