NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255252_1001956

Scaffold Ga0255252_1001956


Overview

Basic Information
Taxon OID3300024853 Open in IMG/M
Scaffold IDGa0255252_1001956 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2924
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)45.0061Long. (o)-74.7949Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013634Metagenome / Metatranscriptome269Y
F031456Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0255252_10019561F031456N/AKHMAQIGSFPASASAVFNLDFLPEKFLVVATGASQALSNFSVVTAGVQLMSITALARINALARFDSGTILDGAAPANQQAAAYLRLATGRINKGTTITGTNSVAAVRNVFAASTNISNVARRAVEQSINPSANATFDSFEALLFDPANLLRAQITFANGYTDEYTPQELQALYANYHVAEADGNVNGLTIIDADSGAGLISQVTLFAGAGAAIVVLKTDYVQL
Ga0255252_10019562F013634N/AMSNCNSSKPMAIPLAAIGAGLGALQQSKIEKALAGEKTYTKPKTIFGKLIGGVSGRTAAAEASQTKTSPLSENVMNSLQPNERAKTPVSGGFSFGGEASKKTYLPFAIVAAIVAAFYFMRRKGGRRRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.