NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255271_1025607

Scaffold Ga0255271_1025607


Overview

Basic Information
Taxon OID3300024864 Open in IMG/M
Scaffold IDGa0255271_1025607 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1280
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010764Metagenome / Metatranscriptome299Y
F030059Metagenome / Metatranscriptome186Y
F091921Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0255271_10256071F091921GGAMIEMRVVLHENRINPEIQYRFMLFSMGQGGYLCPPNPDMKWSEWRTCPYVNAEEIEND
Ga0255271_10256072F010764AGGAGMIEIQKNYKLTLTEQLARELYWILKDVNLDVDNELKLVYHELKKLFDSGIR
Ga0255271_10256076F030059N/AMNDTINKNLTLIQEVANKALELHKNSTERFGGVNYADLRVVDVWVKYSIHEEDLEYGVLIEECSPTAYDFQDYMLEYL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.