Basic Information | |
---|---|
Taxon OID | 3300024999 Open in IMG/M |
Scaffold ID | Ga0209728_1000580 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Rifle, Colorado, USA - Groundwater D1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 27803 |
Total Scaffold Genes | 27 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 18 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rifle, Colorado, United States | |||||||
Coordinates | Lat. (o) | 39.55 | Long. (o) | -107.97 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071896 | Metagenome / Metatranscriptome | 121 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209728_10005809 | F071896 | N/A | MAKTIKSNEFNTIDPDRKVRIINNSNSKIYWTQLNGRPINLMKIAAPASLPYVELENMAYTSDLIQTGDIYVPDKDVFDSLGIINLKHEDIKLHSELKRMLANLDAEELKEEISKLPDGNKELLAELAINEYNNLKGSVIDTIEDETKVKISLMKEDEKANKENQEKNKK |
⦗Top⦘ |