NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210049_1097103

Scaffold Ga0210049_1097103


Overview

Basic Information
Taxon OID3300025036 Open in IMG/M
Scaffold IDGa0210049_1097103 Open in IMG/M
Source Dataset NameGroundwater microbial communities from aquifer - Crystal Geyser CG06_land_8/20/14_3.00 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1494
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location
Location NameUSA: Utah: Grand County
CoordinatesLat. (o)38.9383Long. (o)-110.1342Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004515Metagenome434Y
F010074Metagenome / Metatranscriptome308Y

Sequences

Protein IDFamilyRBSSequence
Ga0210049_10971033F004515N/AMVQTVLSKTLQPGQKSILLEKPLVSYRIFFSIRALADQTAWYQSRISFDDPLFRFYYVLDGPGKYFEAKGEGIFQGNVWGLNASTESLQYTATEILV
Ga0210049_10971034F010074N/AVRTGIQKIIQASKEKIIPFRSSKADRLNAISELNRLAEKKKEKRVITIQEKILANFSDTCINFIREYFFIYSHTIFSPIKYMNIGLTQIRKDPRFIANASLKNNILSEVKTACDKLLTACHQTNEHTTTLNLPQNQT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.