NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208018_112137

Scaffold Ga0208018_112137


Overview

Basic Information
Taxon OID3300025057 Open in IMG/M
Scaffold IDGa0208018_112137 Open in IMG/M
Source Dataset NameMarine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1161
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)28.867Long. (o)-90.467Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001807Metagenome / Metatranscriptome631Y
F074793Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0208018_1121371F001807N/ASFTGTHVTITAVVDEMRLLYRATYFEPEEWAPALCTTTIELDPEEPIPLDEDGFCAYLDHLDPQWELLDTSDE
Ga0208018_1121373F074793N/AMHFHLPSNLQQELLAYDPKLKALAKQAENKAPTKKAKYPLGNIPHLIPENVVRSSYQQEAIDHINSQLAPGRFRLFTKLVDVATPQARTVPVAILYHFEQCWYAAWLPQRGEDYVYGYAYAFKNTSAAAKQVPRHIWNHKEICTEHTIGRGAQVFTYAATVTKQDIINGKDDRNWRAMGIASYYQKARDITEAITRFESQLMTKVPQWSDCHSIFERLRCNNIVDALEMPA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.