NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208920_1001152

Scaffold Ga0208920_1001152


Overview

Basic Information
Taxon OID3300025072 Open in IMG/M
Scaffold IDGa0208920_1001152 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6750
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-16.21Long. (o)-76.61Alt. (m)Depth (m)105
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016734Metagenome / Metatranscriptome245Y
F036473Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0208920_10011526F036473AGAAGMITSLATLKATLLDKVCEVKFARRNSKPGRPATRRMLCTNNVQLLNSVEGRVVLNYAPPHQGLKYNPNQENLIITWDILMQDYRTINCDTVDLISTLEADQTFWTYLNEKIVPMSAGQKLDFMNT
Ga0208920_10011527F016734N/AMNKRQKQHYEKQLDKMDLTDSQRDSFDHNPKRSLVDLEKYQNTDTFSLQGFKLSKVLDDIVLAQFVDLANDGKSVMRNGIHIPLAQVQRTWRLAKVILIGPKVEYTTVGDIICFPDDKGIKVDNMSVKGYDESLRDCIFINEERFFGICEELEEHDN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.