NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209615_100111

Scaffold Ga0209615_100111


Overview

Basic Information
Taxon OID3300025075 Open in IMG/M
Scaffold IDGa0209615_100111 Open in IMG/M
Source Dataset NameFreshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8871
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (62.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Indian Creek, Illinois
CoordinatesLat. (o)41.6655Long. (o)-87.5437Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004362Metagenome / Metatranscriptome442Y
F006502Metagenome / Metatranscriptome371Y

Sequences

Protein IDFamilyRBSSequence
Ga0209615_10011111F006502GAGMNPEKTTIMIGLLGDKPKMGMKEEGGLLAEDKSSCPLSTMDADINKGNMKKAVLTADYGSKKDGEGKCKACEYFNTELTDCGVPKGKGHCDIFDFVCDQNNGCMAWEAVGEEEMEMEDEE
Ga0209615_10011112F004362AGGAMESRLQNWAWYVTYGVIGPQVETTCRSFEKNYIPELGNLYAEPEPHYEPDHVDGDLIEQAIKGLPLNLRQALKLRYVSHPYASINQLANAARTTVHKIEADLLNAKKRLQHELDRKAKSNHYKSLLKMQDQQID
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.