NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208156_1001093

Scaffold Ga0208156_1001093


Overview

Basic Information
Taxon OID3300025082 Open in IMG/M
Scaffold IDGa0208156_1001093 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9066
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-13.003Long. (o)-80.809Alt. (m)Depth (m)275
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008778Metagenome / Metatranscriptome328Y
F035959Metagenome / Metatranscriptome171Y
F051056Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0208156_100109310F008778GAGGLSRSGALAQIDTLLAAISDPAFVAVYRGEPLAIAGTPVLAFWLTGRRSDFETLGDIGSVVTVTIRAYFRMQDSADVRESIEEEVWDAMYQIDSQLRSDADLGGNVTDSSVGAASVGYQNMSGGVFRTVSVPYEMELYGEVTITP
Ga0208156_10010937F035959GGAGGMPKAKSLVNVTFGATGEVYEMGQTYDVPAEILKKYPDYFKVSKAAANKQAATEENK
Ga0208156_10010939F051056N/AMPPTPTTSFKLKGPMFEKPTQISLGFAEAVNRGLLDLATIEGSNKVKEQLYPGHGRITGNLRNHIGASIVRDYVSQVDAGEARYGANLIYSNWVEGISSRNQASVFRGYGVFQNAYDHIQNNPKLYEEYIGDALIEAFD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.