NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208298_1011137

Scaffold Ga0208298_1011137


Overview

Basic Information
Taxon OID3300025084 Open in IMG/M
Scaffold IDGa0208298_1011137 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2197
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.51Long. (o)-76.2Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099109Metagenome103N
F099342Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0208298_10111372F099109AGGAGMGRKIRYYRNETTDPRLEKGKLYTMHELAKRVKQSPTTIRSRVGTGDTVTDEHFISKKVTRSIWPVFETEIQEKSSQWLRRKL
Ga0208298_10111374F099342GGAGLSNATDFLTNRERDNMSEDYREAMSIARLQGQDFHDWTQTFKPDYRELVVIDSDGCRTFDLVYTDGDGGVMVFSNYSEIFNDKGITMSVVGGYCDIAFEHMQEIMAYMEDEMERMTQALDNERE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.