NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209822_1023239

Scaffold Ga0209822_1023239


Overview

Basic Information
Taxon OID3300025092 Open in IMG/M
Scaffold IDGa0209822_1023239 Open in IMG/M
Source Dataset NameHot spring microbial communities from Little Hot Creek, USA to study Microbial Dark Matter (Phase II) - LHC4sed_matched (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1719
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: California, Little Hot Creek
CoordinatesLat. (o)37.6906Long. (o)-118.8442Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074155Metagenome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0209822_10232392F074155N/AVVCSHCGLVWSVENSTDYVPFPEHESSDGGEGSRFEGHWQPGNTLAFLKGLGDPTLANSRGKGKALMRVLAKSPNGAVDLGLRARYVKTLVEWEDPPQLRKVLSRISLLLTQMGQRENWLLADYTGNLARKIVAFKLLTCQTVNANVGDAVVAYAIEKFGLKVKPPDLKADADDLELARTLDKVKDKWNPQAKKRIATPSLT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.