NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208794_1004092

Scaffold Ga0208794_1004092


Overview

Basic Information
Taxon OID3300025093 Open in IMG/M
Scaffold IDGa0208794_1004092 Open in IMG/M
Source Dataset NameMarine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4700
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameAtlantic Ocean: Gulf of Mexico
CoordinatesLat. (o)28.867Long. (o)-90.467Alt. (m)Depth (m)18
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063611Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0208794_10040927F063611N/AMALSTKDLGTEGTGGGLPKTISPGNNELKINEIRLEEFKFIDGAYHLIIEMETKPIDGFQGFMRDRNDESKGRYEGQIGRVKASQYAFADGETKSGIKIERDNSIMIFLKNFSAALGITDWFHEQDNKHETIEDFVAYYNENAPYQDKYLHVCLAGKEYQNKSGYIAYDCWFAKAQNKKYGYTPTADNVLTYDESKHLRKLENKPVDSFGNDDDDLSIPMKTSSDFSLD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.