NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208011_1000653

Scaffold Ga0208011_1000653


Overview

Basic Information
Taxon OID3300025096 Open in IMG/M
Scaffold IDGa0208011_1000653 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12840
Total Scaffold Genes37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (72.97%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED197(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-11.499Long. (o)-81.405Alt. (m)Depth (m)120
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018196Metagenome / Metatranscriptome236N
F023368Metagenome / Metatranscriptome210Y

Sequences

Protein IDFamilyRBSSequence
Ga0208011_100065328F023368AGGAGMHKYNKSTTKYKDVPIEDKIFSYLDKQDTNNAETLCMLLAHLSMPTMCCSWVSEEHFNNLLEKYKIDITPYVKDDERITTSIKSEIADEMFKLVETGKYKKRNLIKVLREKFKDVNAGVIHRLIKKNLSLRILEIDRTYKTKPYVIKGKYYIGG
Ga0208011_100065336F018196AGGAGGMRADDITKAVEYKQGHFNMVQYILKEKPEWSISVYDKETGETPVEYSKDYEEIRKAIKDYETEIMVYEKNNKQIGWAWFIPYNETDEDIVTDYSDTLTLNKWAKQFEELHKQLEGA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.