NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208159_1004473

Scaffold Ga0208159_1004473


Overview

Basic Information
Taxon OID3300025101 Open in IMG/M
Scaffold IDGa0208159_1004473 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4427
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (23.08%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.198Long. (o)-77.499Alt. (m)Depth (m)38
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023483Metagenome / Metatranscriptome210Y
F028800Metagenome / Metatranscriptome190Y
F078595Metagenome116N

Sequences

Protein IDFamilyRBSSequence
Ga0208159_100447312F078595N/AMKNNNNFIVSDFEIIKYNLLNLNNELVNSYLELFSSDPDNMPDFKYVKKLNNFLNKINSNYICVNKLDVNNEGEIEWEFKLK
Ga0208159_10044736F028800N/AMNKIEIIDGHDGFEREVTGTYNLDGNNVYEWELYTYDGLTSIYFKDAEADFSLEDEDDMEQIGLTEEEGERIFDEILDFVNDNGYSFIGEEFE
Ga0208159_10044738F023483N/AMNKLHLSIADVTKIYGEALEHETGMPVNNLANVFDYDGYRLNYDSLADNIIIKILGAYVQFEMEDTDITCINNNDGKGWFFAY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.