Scaffold Ga0209126_1168851

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209126_1168851

Scaffold Ga0209126_1168851

Overview

Basic Information
Taxon OID	3300025119 Open in IMG/M
Scaffold ID	Ga0209126_1168851 Open in IMG/M
Source Dataset Name	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	582
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location Name	Rifle, Colorado, United States
Coordinates	Lat. (^o)	39.53	Long. (^o)	-107.78	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088677	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209126_11688511	F088677	N/A	CLGLYFAKKTIFETSKAWVGATLVLSLVTVLFRGMASICNCNWYTDPATGEPTQLVPVTYLLIAGSFFAILYNFNIPPLKKFKWFISVPLSIPLALVSDIVFPLTASRPPWVFIEIILLAPIGAVYSSFVYEKAVLHMGDYRARLRRFFDQTEKGKKGGPALAPEKEGFTYFTYALLGRKLNKALPFFKSLKG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.