NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209644_1005257

Scaffold Ga0209644_1005257


Overview

Basic Information
Taxon OID3300025125 Open in IMG/M
Scaffold IDGa0209644_1005257 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2586
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-108.7999Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002566Metagenome / Metatranscriptome547Y
F042378Metagenome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0209644_10052573F042378GGAMNISDAIAEVQQPRSRYQLVHFVIGQHDTPEMRYYQLCLELQDMGYKLRLAALGVRKAEVEIARLLETGDELDAIEAEEKQVGLEQTRIVMRGAERELAILTDLFDESTHYTRAEIEHAQPEYWKARLTRQTNLQLMAGSVGWAQLDSMRQAGLLDELIAERERQTTNGHQELLP
Ga0209644_10052574F002566AGGAGVIYLKWKLSDGTSGTGPEETIADRGGLADASWAVDAAGYRIGYLPQTANVDDLGTWDVTEPTEAAALTFCQALYADAEVLPDGRISGPPPDDDV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.