NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208299_1056264

Scaffold Ga0208299_1056264


Overview

Basic Information
Taxon OID3300025133 Open in IMG/M
Scaffold IDGa0208299_1056264 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1473
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.51Long. (o)-76.2Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074050Metagenome / Metatranscriptome120Y
F077815Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0208299_10562642F074050N/AMNRSYITKLVKEEIHSLKNEASNRAVKRGTVTDNARLAMILTSLGKRAKGSFQKRKVVSQVIMALASSLEITPNEVLRAYIDYKKDAKGTASSKVKKDD
Ga0208299_10562643F077815N/AMQGTDLRNRLKQIIREEVSSCLKEESYKFGTLADPKDMDPNDPMIKVNGFASLNRSSVRNQIVDRLSGALATAKDAAKGGPNSYQAYKQLQDLISDSGILYKLIGAELDVANALEAKRLKGGRRTIPIPKQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.