Scaffold Ga0209381_1005760

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209381_1005760

Scaffold Ga0209381_1005760

Overview

Basic Information
Taxon OID	3300025161 Open in IMG/M
Scaffold ID	Ga0209381_1005760 Open in IMG/M
Source Dataset Name	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9807
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (54.55%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Canada: British Columbia
Coordinates	Lat. (^o)	49.9543	Long. (^o)	-116.5155	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024517	Metagenome / Metatranscriptome	205	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209381_10057601	F024517	N/A	MYGLHTIQDVHRLVKAFAGVPDCFVPLKTRREISYPLSFRVPLSQVEEIDAAAAREKRKRRSDLLEAIWEVAWAEYKRAGSLEAYASGRRGRGYTRRVSEELQDQIFTAVELILERAPSAVIEELARKLT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.