 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300025162 Open in IMG/M |
| Scaffold ID | Ga0209083_1002088 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 19925 |
| Total Scaffold Genes | 17 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (58.82%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Lake Alinen Mustajarvi | |||||||
| Coordinates | Lat. (o) | 61.2 | Long. (o) | 25.1 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039794 | Metagenome / Metatranscriptome | 163 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209083_100208817 | F039794 | N/A | PRGTRLRLAVSAHPMLPSASSYGVGIPEDISFAAEYPARTFPCQRFDAALTSGSA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |