NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209674_100039

Scaffold Ga0209674_100039


Overview

Basic Information
Taxon OID3300025226 Open in IMG/M
Scaffold IDGa0209674_100039 Open in IMG/M
Source Dataset NameArabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)402292
Total Scaffold Genes384 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)261 (67.97%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.6667Long. (o)-78.5097Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035339Metagenome / Metatranscriptome172Y
F049682Metagenome / Metatranscriptome146Y
F060114Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0209674_10003930F035339GGAGLPAARLTLAQLRSDRILIWCWLPLGGFAMFGIVKAWQHVAGEPPPGLYTTLDVLWIAVTFALIARRSTARCPRCDHRWLRAFPWMSLRKVECGVCGHEMPER
Ga0209674_100039379F049682GGAGMDQREFEAVVDEFGADVQDLVELVETARYEQATAVEISRLLDAREDLLVLVNKLPALRAAEPPVEMNVPLASLRTRIAHAREALKSSHDSKEILQMVAETGETFATIVAPLQAAGRWPKGRSR
Ga0209674_1000398F060114N/AMTSPLTELFEQQRIENARLSGQIVALEMAVKLLFMQHPQPNALAGFYSKAIDGLLDITLATRMPEEMRDALDQARNGLLEALRQQPTLGGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.