NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207908_1011442

Scaffold Ga0207908_1011442


Overview

Basic Information
Taxon OID3300025244 Open in IMG/M
Scaffold IDGa0207908_1011442 Open in IMG/M
Source Dataset NameMarine viral communities from the Deep Pacific Ocean - MSP-81 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1254
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-28.4105Long. (o)179.1447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089415Metagenome109N

Sequences

Protein IDFamilyRBSSequence
Ga0207908_10114422F089415GGAMQRLQANLYSVFLTEEREGPPNEADWLYESDICRRELPSGSGRTYCESLKPDSLHVAQYLAYHRIKWFDGTKGKMVVGKRGQPRMCRCGNTESDTGAAKPQMW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.