Scaffold Ga0208570_1001086

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208570_1001086

Scaffold Ga0208570_1001086

Overview

Basic Information
Taxon OID	3300025249 Open in IMG/M
Scaffold ID	Ga0208570_1001086 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Deep Indian Ocean - MP1202 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7968
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	South Indian Ocean
Coordinates	Lat. (^o)	-30.33	Long. (^o)	103.31	Alt. (m)		Depth (m)	4000.85
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045995	Metagenome	152	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208570_10010868	F045995	GAGG	MWTNNIVTFYGADEDLKKVAERLYSPGETSEEDNCFDFNKIIPFPNELSYIHSSRFNSGKKMIHGREYEQWYYVNSDGKMIENNPDNYFEKSRLKGMSSRMEKQFMRKYGALNDTDWRAINWGTIWNSNSGPGEKYREKLVYNFRTNYGSARLIVLEIENMIYRGEFPKVKMMWEHDNVDVHLCFMEDDEYVPDPTPVFTVGFAETEKSTAEYYKW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.