NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208182_1001862

Scaffold Ga0208182_1001862


Overview

Basic Information
Taxon OID3300025251 Open in IMG/M
Scaffold IDGa0208182_1001862 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9212
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (73.68%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)43.29Long. (o)8.1Alt. (m)Depth (m)2535
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001594Metagenome / Metatranscriptome666Y
F007267Metagenome / Metatranscriptome354Y
F007647Metagenome / Metatranscriptome347Y

Sequences

Protein IDFamilyRBSSequence
Ga0208182_10018622F001594GGAGMEKTKLTKDEYLDSLDPDNLNLEKKDLINFCHKCVEEWKQNKVGNFKFIVAMELIIAGVKITPEDVLKAVWKKILVWFWDLQFKNALADNEGMLKKLREVGSG
Ga0208182_10018623F007647GAGLDPAKVNHVVNAFFTSLRAEEDRMLETGLTHNNTVEVLRQAVIGLVESNPKRFQQYVKFFEEGCMYLQDESEELPEVDEIGR
Ga0208182_10018625F007267GGAMRLKIFTCPECKFRKFESINALNVHIGKSHTVDYKISIINNKPVFKKKTRASVQYIKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.