Basic Information | |
---|---|
Taxon OID | 3300025256 Open in IMG/M |
Scaffold ID | Ga0209759_1010274 Open in IMG/M |
Source Dataset Name | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2753 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of North Carolina, USA | |||||||
Coordinates | Lat. (o) | 35.9082 | Long. (o) | -79.0499 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033107 | Metagenome / Metatranscriptome | 178 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209759_10102741 | F033107 | GGAG | MRLLTSLALITVAYAALARVNKVHSARFHAKPAAKPEEVQTWEGEGGGLPTGGPGPGVKVAPAA |
⦗Top⦘ |