NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208029_1016783

Scaffold Ga0208029_1016783


Overview

Basic Information
Taxon OID3300025264 Open in IMG/M
Scaffold IDGa0208029_1016783 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1895
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)39.48Long. (o)6.37Alt. (m)Depth (m)2851
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022083Metagenome / Metatranscriptome216Y
F040340Metagenome / Metatranscriptome162Y
F089036Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0208029_10167834F089036AGGMKKIDLQGAILAGIGTLIVGLTGWLMSTTLGVDKDQDVMEVRLDHAEENYDKLRLDSPAHSMDTCPVCMHMKLGSK
Ga0208029_10167835F040340GGAMTWFYLHCVIAIVIVIADARGTLEPTIKKWEEKLGIPVPEEVDAEADIREQQSKH
Ga0208029_10167836F022083N/AMLLQAIGFIAAMVYGYGQLNTRLQFVEHQAEMNEKTIKEMKSLQDAPIPSDVRQDEKLRRIEEEITRLRDGKGD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.