NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208180_1046645

Scaffold Ga0208180_1046645


Overview

Basic Information
Taxon OID3300025277 Open in IMG/M
Scaffold IDGa0208180_1046645 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1133
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM23-C198(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)39.48Long. (o)7.24Alt. (m)Depth (m)2766
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003481Metagenome484Y
F006447Metagenome / Metatranscriptome373Y

Sequences

Protein IDFamilyRBSSequence
Ga0208180_10466451F003481AGGAMTTPDDVQEELRLAREELARLKATDDKSDKIQMTSSDIVRLVIAAPVVFTWLFLGSRIIISATTSQHVLSNVEPLVMTLSILTIPVTGILQSLFSAPGQNGK
Ga0208180_10466452F006447N/AMVGDRRIPSPRLPAFKMFRVGFANRHVSTVVVMAIVVSAAAVSVGLYFAIKDVASSTYNWPEPAQYAVTAAGLETMGKKNEDYPDGTESQTLSIRLADGARISTLRIKDTDLGRSGISRALDISPLTSAVTGATAYLWVGNLTVTNSSFPTFKMETSDVANLVTGVLCDGHTMSATITNTVPDMVLESERLSSVYEVDGSVVDRIQIHITGTSGAFVENLILDNVDAWNGQAYLSRMKIGTMTMNNSNKVGDGSG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.