Scaffold Ga0208047_1099127

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208047_1099127

Scaffold Ga0208047_1099127

Overview

Basic Information
Taxon OID	3300025279 Open in IMG/M
Scaffold ID	Ga0208047_1099127 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	735
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Rwanda: Western Province
Coordinates	Lat. (^o)	-2.0288	Long. (^o)	29.1756	Alt. (m)		Depth (m)	220
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038042	Metagenome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208047_10991271	F038042	N/A	YLSLKDQTICMKKGPKPLTALLTLKILELLTEVSYDMRTWTITMRLRQSTGRPSLKWETVHKYLQKMVQEQMIFRYEDPTGVVTYSKNPIVREKVLF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.