NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209431_10407881

Scaffold Ga0209431_10407881


Overview

Basic Information
Taxon OID3300025313 Open in IMG/M
Scaffold IDGa0209431_10407881 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1048
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Cloacimonetes → unclassified Candidatus Cloacimonetes → Candidatus Cloacimonetes bacterium HGW-Cloacimonetes-3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.534762Long. (o)-107.782602Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010634Metagenome / Metatranscriptome301Y
F036898Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0209431_104078812F010634GGAMRLFVVVQGDEIVVTSETGFRAAYCKRPNFPQLKVRRRTDTDDHELLAQAWQAASAKARELGWIT
Ga0209431_104078813F036898GGCGGVTQRISDIEVSRRRLRIFLANRAIALGWALKDSCKPCANRLFTAARWLVPEAQRFLVHRTGSHNRNRWIFGVALDLGTLLSRMRPLGVVAGFLIVLVFLGSLDLVMRATATGTQPLVENSAFQHETRTSSESKVSSVSKFSEPMQGFVSETGSLSGAQIAP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.