NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209739_100507

Scaffold Ga0209739_100507


Overview

Basic Information
Taxon OID3300025360 Open in IMG/M
Scaffold IDGa0209739_100507 Open in IMG/M
Source Dataset NameHot spring sediment microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC3_ASED (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15762
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (16.00%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families5

Taxonomy
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameJoseph's Coat, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062912Metagenome / Metatranscriptome130Y
F077497Metagenome / Metatranscriptome117Y
F090626Metagenome / Metatranscriptome108Y
F097670Metagenome / Metatranscriptome104Y
F099549Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0209739_10050710F097670N/AMTSYKIFDKEIFFETDHIIIIDSKTNEIKHEEKHYFYDGKELKEIKDLYEYNLKVYEISQKIQEEFTKFSSKHAKPPIGYVTISNMIFEYMLARNNVILIAYANINKLEKEISKEITDDTIKIIFKSKTIINKEWNFESIQNLPNDIKDNVTKLIEKALKSAMVMLKKNT
Ga0209739_10050714F099549N/AMDTNLQYSYQIPDLKTRFQIGFGNIIEQIIELLTYSGISTDTKTFDDEELKYKLRAAIAYALALLGSTWGYSISAKTQMEVQIAKESLKALFDRIVTDPEITYPELLDIYYELIQKVSIILNYGTPIPQPKTGTYDIT
Ga0209739_10050720F077497N/AMDKEAINKIEEILEKHLFMETNNPDYELKKIDVIIKYLIYQKLKDIDETLKSIDENLFISANKGIYEE
Ga0209739_10050722F062912N/AMDPLEVLEKAYNLFLASEIIESESSIDKELEQLLLNRDYEKMAKTLLYILVYTLNRDPAYKNIRNIYISEAIDLLYVIDRIGFNDERIIKRFVHLLYRFYSYSLEYKIKFITDNGKRELIKAKLNELVNII
Ga0209739_1005074F090626N/AMPRIFRFRNIYFGSDSLVKLFANKTHLENYVDYDATTLAFLLDVSDFTNTNALLSHFAIINGNEIKPILVEWNLKTIYGRLGILLNQLRGPHDTKILLKRFETIIKENGRPEVIKYAAGQFARALVNAKGLYPIYSFLVQRIYLLKLNGIKRSLEEVKRLDAIYK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.