Basic Information | |
---|---|
Taxon OID | 3300025360 Open in IMG/M |
Scaffold ID | Ga0209739_115628 Open in IMG/M |
Source Dataset Name | Hot spring sediment microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC3_ASED (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1208 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Joseph's Coat, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000750 | Metagenome / Metatranscriptome | 908 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209739_1156282 | F000750 | N/A | AFSCGDAYCPGSPGSEAVGVQMYLSVIITAFLFSYWLFRKKFRARPLSLPINVETGDVIHGAFGSLLANLSLHGMYIDVMVGVLLYLAYQFTEFAVKQDAIYKDIATFTAGYFGTIVAGGIPL |
⦗Top⦘ |