Basic Information | |
---|---|
Taxon OID | 3300025360 Open in IMG/M |
Scaffold ID | Ga0209739_129813 Open in IMG/M |
Source Dataset Name | Hot spring sediment microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC3_ASED (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 673 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Joseph's Coat, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077502 | Metagenome / Metatranscriptome | 117 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209739_1298132 | F077502 | GAG | MTDVAHIVIWIEKNLPEEGKLSELIDNVFSLIQEIILNNLSQGKQPISFQSVREIADTFREVIYRSIEQSVGTLTEEVKEQVDAYFFKKLDEIYDKYYS |
⦗Top⦘ |