NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208620_1002555

Scaffold Ga0208620_1002555


Overview

Basic Information
Taxon OID3300025368 Open in IMG/M
Scaffold IDGa0208620_1002555 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2698
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008745Metagenome / Metatranscriptome328N
F042744Metagenome / Metatranscriptome157N
F094895Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0208620_10025551F042744N/AMEALPVAVSGSLYKSALTMIKELKKLVIKLTREGVSCSPSVIQMFDETKRWFMERIRVHFADSQKRYLQWRWRAAEKMFLQFREGQALTAAPALPIAIRSREMARPLHSPLANARGKAADLHLVLQPQMGQA
Ga0208620_10025555F008745GGAMSNGYQITEKERDMLVCPRWECMGAQELLDVWLLPLVQEVGGILEEAYCTSHQLLPRGGQGEERTLGLLQHKLMTAITELEVVQGWIASSCNMSSDKECRVLDGEEDKSEGKVLKEGSEANQSADQQADCGKQKSTSYYQWKLRHE
Ga0208620_10025556F094895N/ARRSFQTTKRLDDWLRIMEEVVKVLGILYRSSFRLLESNNFKDESILDLLRTVYISAMAEVDVVKGERT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.