NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207957_1000387

Scaffold Ga0207957_1000387


Overview

Basic Information
Taxon OID3300025372 Open in IMG/M
Scaffold IDGa0207957_1000387 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10282
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027087Metagenome / Metatranscriptome195Y
F086513Metagenome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0207957_100038712F086513AGGAMTKKLEPGPWAVDETLTGPQVDAPGAIEPPKAASETTKATKETPKPGETNIEPLYDFEGLMTDFPTAKDLEKFVFDQTGIVLNLKGRSNKFKYQKAMDVLNGKEPEEYLLGNENPYLDKNDLIPIDDLKKLPARPAAVVGEQCVASFISKTFQHPDQEWAAQGQKCEVVFRKYINNVITYEIIGPISTRAVGTRVNKFGKEVPEKYVWVDPRTGEQVIRKENGSYTPVGTRLRAKMQAAKINKSDYWSVWIDREFVISDGTNAIDNPWGSQL
Ga0207957_100038713F027087GGAMVDGPGFDANQARLVADTKILQKVNAVHRDAFLSKYPGQVEHCLRLTMERLQAGLDKRGEVLIDNPETWRMSTVELQELANTAYLLNEIRKGF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.