NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208380_1000783

Scaffold Ga0208380_1000783


Overview

Basic Information
Taxon OID3300025392 Open in IMG/M
Scaffold IDGa0208380_1000783 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7897
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066311Metagenome126N
F081067Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0208380_100078313F081067AGGAGMTRFTEKYVRSDNQWVKITRDNVQRTFTFARGYKNEFKAHEISTLSFKWVSNWTEALEKANKTIAIFA
Ga0208380_10007832F066311GAGGMISWFFEGLFYYIALLAFIAGLALYGVSYFAKLLPVIAAYALMMQIGGMVMAVGGGYFVADHKGYERRVAEDKAEIDRLNAEAREKEVQMAQAIKEKTAALRKATNAINQKQSDTFKRIDSGELRFPTSCSVQADSSTGTTAGNPSNGTESERQAVKDIVTIAAEGDIAITRLNACIAQYNNVRETINAGVK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.