NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208874_1035656

Scaffold Ga0208874_1035656


Overview

Basic Information
Taxon OID3300025396 Open in IMG/M
Scaffold IDGa0208874_1035656 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)736
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Chytridiomycota → Chytridiomycota incertae sedis → Neocallimastigomycetes → Neocallimastigales → Neocallimastigaceae → Neocallimastix(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000350Metagenome1248N

Sequences

Protein IDFamilyRBSSequence
Ga0208874_10356561F000350N/APGHGISFRAVEDMVSKCAICQKDRLGMDGYVEPVYRHLKKAHSRGAVGVDLLTVTPVDEAGNTCLIVIVVFYTKYVWATPAKEYTAHTVAVALFTFFCTFGMYDELWSDPGSDLMAEVVQKLSEWMGIKRVISLVDRHESNGVEGSNKQILRHLRTLVHDLRVPKKWSDPTILSLVLFAVNDGINSETGVRPLDAMFGSDDSPYLRLPDSVDPASITSAWVRGLDEDLRHIRSKSSAFQAELVQE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.