NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208936_1000824

Scaffold Ga0208936_1000824


Overview

Basic Information
Taxon OID3300025404 Open in IMG/M
Scaffold IDGa0208936_1000824 Open in IMG/M
Source Dataset NamePeatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4066
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017172Metagenome / Metatranscriptome242Y
F050705Metagenome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0208936_10008241F050705AGGAGMISKTLRIARMFVLASVSLSSAAWAATCSNASLSGTYGSLGEGTNQEGQP
Ga0208936_10008242F017172AGGAGMNKFGKYFLLVTGFAMLATLARIPGAVINVHAHDQACSVASLKGTYAYLRTGVNSALGGPVAEMGLDVFNGDGTRGIIRATGSSLDGSYDWTDYSWPNGSYTVYPDCTGSLLAADGTKANIIVLDGGKRFSVLSGLNQTGKVVTGEGTRLEEEKD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.