NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208193_1000274

Scaffold Ga0208193_1000274


Overview

Basic Information
Taxon OID3300025463 Open in IMG/M
Scaffold IDGa0208193_1000274 Open in IMG/M
Source Dataset NamePeatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)32212
Total Scaffold Genes47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)42 (89.36%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m).1 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002897Metagenome / Metatranscriptome522Y
F017679Metagenome239Y
F027194Metagenome / Metatranscriptome195Y

Sequences

Protein IDFamilyRBSSequence
Ga0208193_100027416F017679GGAGMSMSTTSQPRRRRSRSDLVHLRSLPSAQPATKIGQVTWAWGEIEAGLAAGMKLKEVWEAARKDGIDTSYAQFRVYVSRLRCRQRSSIAPLPPPAVGNGASSHTDLPQPDPFSNLREQREKKKKDAGFEYDPFSINRDLTD
Ga0208193_100027417F002897GAGMPRRTIRLTADIDERLQSTAKLKGYANPSAFLRAALDHELSGREDTIIGAEERLAASMEQMRREVFRLGRAQQALFAFVDSLAKVLLTCVPEPGGEAMDAAVARARGRHARLLKSAGQAMVGDSELALRDLVNNREGL
Ga0208193_10002746F027194AGGAGMTIQITRPEVEALIETRLKSGKFRDAEDVILQALQSSETESPQPVAQRDEAIECLKTFGKVHGLSLGGMTIRELRDEARP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.