NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209012_1023188

Scaffold Ga0209012_1023188


Overview

Basic Information
Taxon OID3300025503 Open in IMG/M
Scaffold IDGa0209012_1023188 Open in IMG/M
Source Dataset NameFerric oxide microbial mat and aquatic microbial communities from Rainbow Spring, Yellowstone National Park, USA - RS3B (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2116
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033508Metagenome / Metatranscriptome177Y
F047176Metagenome / Metatranscriptome150N

Sequences

Protein IDFamilyRBSSequence
Ga0209012_10231881F033508N/ALAAEAAPAPFVSSTTLRRVSGSSTTQLTIPARIGHRHVLYDVFVSYAPTYGYADVAVGTRVFIRLPFGVANCVTVDAPNQKVEGKGFLWGLSDLFGPEHLPNAAEDEDINITLNAAATRVDAYYAEIKPEDVTSHSVPGGSDAKIKPFIELLDTLVTTTGNGINVLNENMPTGLGLLDNNGRVKATTQFTLLTMFADYTSSGTNYTEYSRLHVFDEDEELFTPLNHEGLLIDYVNGLSDLYINWRYRQYFKPDQPYVFKPNHQVSLKADVPAVTGSGSTLRVALIGVRERIG
Ga0209012_10231882F047176GAGGVSAMATRIFRFYITLSAGQANNGASGNPAPFTITAPSGINRRIVEIRPWGTQAFEFQGNYDTELYHDIDSNDINTYHRPHYVALDINGTHEYSVVVTNNGTATGTFGVDLVVEESALAAGGAAAPAAGGA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.