NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208937_1084773

Scaffold Ga0208937_1084773


Overview

Basic Information
Taxon OID3300025506 Open in IMG/M
Scaffold IDGa0208937_1084773 Open in IMG/M
Source Dataset NamePeatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)712
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m).4 to .5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003186Metagenome / Metatranscriptome502N
F098291Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0208937_10847731F098291N/AAAQGSPFTVTAVRHLRVREESGAMANFEEISVNPSDFSNPPAKGDWVTAWGTQYVVTTVRQPDAYGMLNLALLQRS
Ga0208937_10847732F003186N/AVINPKTILGEWVTALQSCPDLVTAIGGNGSNIRAFMEGLATDNNLRLAILQMPPGSVLVAWNGTTPRRLTGGSLHFAHRFSIYLRAPEQDSTATYADLFWLLVSAVPTGAPSWESLLHFQIDPDCYPMDMDLPSAQRNTVVVSADGATLDYFEVQATLVEQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.