NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208584_1059062

Scaffold Ga0208584_1059062


Overview

Basic Information
Taxon OID3300025533 Open in IMG/M
Scaffold IDGa0208584_1059062 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)975
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow Environmental Observatory site, Barrow, Alaska
CoordinatesLat. (o)71.2999Long. (o)-156.61Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021887Metagenome217Y
F042085Metagenome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0208584_10590621F021887N/AMVTRTDSGVERDSLVAFRRPRRGPDDLPALALRPLIAEYTATFGSTWRPVTRRKHADDFARLIAWLEANGLPVMTTSLDFMTLVDYVGYLRVRPKVSGVWRGAPDALGRSLRHAPVQTLSANSVNAYVRPLRSLVIWLVDEGLLSSDPFRRSRRRAALNPLLPSEETPTKSATLKDIRALEAGCAGDRPLDLRDRAIVSILKTTAARNSGVRLLRLEDLD
Ga0208584_10590622F042085AGGAGGVLSADDEFRARLRDVLTRSGLSMRALSAAMGRDPGYVAALLDPSRPSRARPTPADLLRASEATGIGFVELLEALWGIERLRLADEL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.