NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208546_1000176

Scaffold Ga0208546_1000176


Overview

Basic Information
Taxon OID3300025585 Open in IMG/M
Scaffold IDGa0208546_1000176 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)29429
Total Scaffold Genes54 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (48.15%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005024Metagenome / Metatranscriptome414Y
F006107Metagenome / Metatranscriptome381N
F009147Metagenome / Metatranscriptome322N
F050368Metagenome145N

Sequences

Protein IDFamilyRBSSequence
Ga0208546_100017622F050368GGAMINEEEVRRLPLWKDWIDRNEHRIAHGLTVTMEEMEEALDGIRETHSFNMEVHNIRRELRHRGMNFSQRGLRGAGFQILPPNTNADEMEHLNRVALNSLKASVILGTRTNLSLLSDCERKRHEAVTEKMAHRLALLGRSNAGLGQDIAKQITQ
Ga0208546_100017636F006107GGAMNAVALRAEKAVADYLAAADWSASGSGTPTCLTSYSRGLYDDPDLEDVMPNFPRLVVSTNSARPVQRVDLTNEVEVSVELQLSADDTDEASVLTTVQVLDNRILPLFDDAGASALDAATNDASGPFTAQFAAPLDFGAASISNRSRTFTRTFTLYCSATT
Ga0208546_100017637F005024GAGGMTVDSSRFDAAMKAYLLSTSRDLHKAINARFFFLMVRLFVLVPPKSPGQERRRIADYLGKPLGDVNRKSKKTGKRIGKSRLLRRVHLIAQSKEAKAGRRGLYGEEMKAAASALMRKAIGSVGYLRSGVVKVIRIYNRGFTQFQSPKWKPLSKPAGYKAPKKTNAALVALANQYGLPEENVAVHKGTKARGIQAVPGFNPTASVVMTAGVADNQYNRVSTIYNTAMQKAMDDELVELTSHMTEAMLANGKVLEENGIAIK
Ga0208546_100017647F009147AGCAGMEYSMGRQGFFPVTTTAAQTGNFSAVIPTEPTVFTSITGTGISGTWTGITLPAGFPLCGDITGFQLASGKAVAFLARTA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.