NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208546_1000549

Scaffold Ga0208546_1000549


Overview

Basic Information
Taxon OID3300025585 Open in IMG/M
Scaffold IDGa0208546_1000549 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13480
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (12.50%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Associated Families5

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002778Metagenome / Metatranscriptome530N
F003786Metagenome / Metatranscriptome468N
F008078Metagenome / Metatranscriptome339Y
F019647Metagenome / Metatranscriptome228N
F045094Metagenome / Metatranscriptome153N

Sequences

Protein IDFamilyRBSSequence
Ga0208546_100054910F019647AGAAGMKIVKGVVKYGSGAPREGQYGPSINILVTLEDGSQVRVYGKPGDVIERYKSGQNIQLIDDKGKYKVVEEEMQQAAKQVQNIDVSEKPDLAAMVFEMSAIYSQAYIDIYNKMSEAGIPHENATAATSTIFIQVFQKLR
Ga0208546_100054911F045094N/AMNEISKIFASYLMDDYKIKGTTEEDVEKAINKIFRFELLDDAQQVLFTSIMNEALDVPWIAEQLTDVWDRYNQEIIDCQKEDYYENR
Ga0208546_100054913F003786N/AMSNLTQYQPRNSDEQAIISARSNRIANMEQKDAYKQTLSVISSVFPMYGIDGDIAFYANIAKEIVKTFGQIAANEIEIAFRLFSAESLELDEDIKFYGKANMHTIGKILNGYMVYRRRIIASHDNEVAALRLQAQMEERGKAEREKLYAEFPTMIKEFAGKTWDDVPLYWYDMCLKFDMITYEEGEKRALWEEAQAIALKEPPDSMDLMTIRSHAKKIEQGNTKRAVVIAQKLAVWRKVIKK
Ga0208546_100054915F008078N/AMNQTPQQKAKFLFVHYHNLIQSIGGELDNETLICILAKQCALFEVRQILKEKWNIDVPGSQDEYYYWEEVEHEIESYE
Ga0208546_10005496F002778AGGAVKEYNAQMMEIKNFCDEVNTWISVAPSAEHLEECDEYLRQLSAYYSRYTVISGMNESIYSQLLMICIRDMSEEEYKRIKHSSTLTDYYVKGKYPKATAIFEQCRAVKQLLLITSDNYRTLLSSFRQERILVGHMTT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.