NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208546_1046226

Scaffold Ga0208546_1046226


Overview

Basic Information
Taxon OID3300025585 Open in IMG/M
Scaffold IDGa0208546_1046226 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1042
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F002060Metagenome / Metatranscriptome597Y
F011938Metagenome / Metatranscriptome285Y
F013891Metagenome / Metatranscriptome267Y

Sequences

Protein IDFamilyRBSSequence
Ga0208546_10462261F013891N/AMLLMDIVKYPDFLALRLYEDNFIQFEGTKKEMVIDYVSKVKKLIESYGVRCELEGVPSARVL
Ga0208546_10462262F011938GGAGVREYSDVIYIVWLHDEQRYGMLEKLGAFASMVKYNIDGEEYEDLVENENFTIVDEIVHQHVEESN
Ga0208546_10462263F000671GAGGMEKILCYSCNKTKAKLDVKKSSLLPINLLMCETCISSKFEPRWVIILAGRSNGPDHVKEFIIRRRYVGNEVSASELLV
Ga0208546_10462264F002060N/AMDYTSIVIALFAATLSGFATALVAAVRDSKKEKVRRAEREQDHLKLEIKDLKIELYKLEKELIDWKDKYYSSIQELIQVKAELENALVQLNIIEFRDMDSEY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.