NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209094_1002882

Scaffold Ga0209094_1002882


Overview

Basic Information
Taxon OID3300025594 Open in IMG/M
Scaffold IDGa0209094_1002882 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8481
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072761Metagenome / Metatranscriptome121Y
F105932Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0209094_10028821F072761N/AALLLVPIAASFLGYQAEVTAAFESFAAMPDWYQYLVLGVYVVKFGMRGLLTKLMSGKLGSLNAKKSQL
Ga0209094_100288212F105932GGAGMDKSQKSKPTKPLRLISADSLEMSRRINNEWRKYKNEKLGSELTQKNAADQIGVSQPMFNQMLSGAVSINPMMVLSVSALLRCDLGALVAELEEYKLLNAVSPTMRSEIPVSITLSGKPVLNRVVSIMTHTMSGAFAVEIDTDEYSPRYSNGEYAIIDPLAKWEIGKQVLVRYGKGACIIRVVSSIKGDEVQTYHPTEVGVNTTVDLSDPSISVCGLIRGVQF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.