NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209405_1093237

Scaffold Ga0209405_1093237


Overview

Basic Information
Taxon OID3300025620 Open in IMG/M
Scaffold IDGa0209405_1093237 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)882
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001319Metagenome / Metatranscriptome723Y
F050304Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0209405_10932371F050304GAGGMRFKKYYKDILSLVGAVLLLGTTILINKYDVKQLYREFATLSLKVNAQEKKIEGLEDKVSTLIVQNQRLLNDLEQHNETRGNENVLLLERLYDLEQKVEILSSKPLVSMTKGKVFNDRFEFEDKQVN
Ga0209405_10932372F001319N/AKKMKKLWSVILLIGLVNAQMPQPTLVGQDELQIPTLSINNFVNQAEIEGLEDTRVFLGITNILNENVMDSRYDLVEQDSDFEMTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKVVSGNGTGTIDREISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.